PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004508656.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27238.1 Da    PI: 8.453
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004508656.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF978.2e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eyss
  XP_004508656.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.24161IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-40160IPR002100Transcription factor, MADS-box
CDDcd002651.64E-42275No hitNo description
SuperFamilySSF554551.96E-34292IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-313859IPR002100Transcription factor, MADS-box
PfamPF014864.8E-2984172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.95688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYSSD  60
PCMERILERY ERYSYTERQL VNNDQAPNEN WVLEHAKLKA RMEVLQRNQR NFMGEDLDGL  120
SLKELQNLEQ QLDSALKHIR SKKNQVMYES ISELQKKDKA LQEHNNLLSK KIKEKEKELA  180
QEELQNSMEV NPIETQTLES MTTGGSLEAK CNEESAAQTR VSASIPAWMI RPINE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S6e-23184183Myocyte-specific enhancer factor 2B
1tqe_R6e-23184183Myocyte-specific enhancer factor 2B
1tqe_Q6e-23184183Myocyte-specific enhancer factor 2B
1tqe_P6e-23184183Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX3088160.0JX308816.1 Medicago orbicularis FRUITFULLb mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004508656.11e-173PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ388761e-111AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBLI1U3J91e-145I1U3J9_PEA; MADS-box protein
STRINGGLYMA17G08890.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-103AGAMOUS-like 8